PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 609aa    MW: 66885.9 Da    PI: 7.0079
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04680.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-094084451954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  KHN04680.1 408 FEHflHPYPTDTDKLMLAKQTGLSRSQVSNWFINARVR 445
                 554459******************************88 PP

2BELL103.41.6e-33282348672
        BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  +kk++Ll++l+eV++rY+qy++q+q+v+ sFe v gl +a+pY+slA ka+S+hFrcLk+ai++qi
  KHN04680.1 282 GRKKSRLLTMLDEVYRRYRQYYQQMQAVVTSFEYVSGLSNAAPYASLAIKAMSKHFRCLKNAITDQI 348
                 68****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.5E-45221346IPR006563POX domain
PfamPF075262.9E-37226345IPR006563POX domain
PROSITE profilePS5007112.098386449IPR001356Homeobox domain
SMARTSM003893.4E-10389453IPR001356Homeobox domain
CDDcd000861.29E-12389450No hitNo description
SuperFamilySSF466894.11E-17391456IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27392453IPR009057Homeodomain-like
PfamPF059201.1E-18406445IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MAEGFEAYHV PQQSRRDKLR VVATQNQHGL VEPSSLLPLY DPSSFISSDL LTSFHNGQKH  60
NLGCGMKEER ANLMMGFAAA AGGGGVMNNG SSSSCCSSNS SSVSYLDPES SLPLNQATIQ  120
VINNSNNNNM FLYQAQNLRE FDQGYNNNNN NNSEIMVFKP EPLSLSLSSH NNGVNLQRYG  180
SVVYGDKVGG VGGGGGGGVV IYGGSGLNEV SRCTVPMGPF TGYASILKGS RFLKPAQQLL  240
EELCDVGGVC AEKIVADASL MEPIPPESSS EDPLGDHGGD QGRKKSRLLT MLDEVYRRYR  300
QYYQQMQAVV TSFEYVSGLS NAAPYASLAI KAMSKHFRCL KNAITDQIQF ANKAHFHISN  360
RKDESPRFGN SDRGPYGQRP GFLEHQPVWR PQRGLPERAV TVLRAWLFEH FLHPYPTDTD  420
KLMLAKQTGL SRSQVSNWFI NARVRLWKPM VEEIHMLETR QAPKNLQKEE HCTNKPSDHL  480
PSDNSIVSEN PSTSTDKFQE APYKRAINEL PNIPVRTQEQ LNLPCTSNQP GGVGVSMGGS  540
ASNSVSLTLG LYQNHGIGLA EPFPLNAAQR FGVALETNNE GYVMSDYESQ NRHFGRDVIG  600
GQLLHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16395452158Homeobox protein Meis1
4xrs_B1e-16395452158Homeobox protein Meis1
5bng_A1e-16395453159Homeobox protein Meis2
5bng_B1e-16395453159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0953250.0BT095325.1 Soybean clone JCVI-FLGm-19C14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516903.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-124BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A0B2P5Y20.0A0A0B2P5Y2_GLYSO; BEL1-like homeodomain protein 9
TrEMBLK7K3120.0K7K312_SOYBN; Uncharacterized protein
STRINGGLYMA01G25710.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-105TALE family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]